Categories
  • Calcitonin
  • Calcitonin

Calcitonin

Calcitonin​​ is a 32-amino acid polypeptide hormone primarily secreted by the ​​parafollicular cells (C cells)​​ of the thyroid gland.

  • Product Details

  • Technical Support

Product Overview

Basic Description

Structure and Function:​
· Calcitonin is a 32-amino acid polypeptide hormone primarily secreted by the parafollicular cells (C cells) of the thyroid gland.
· Its primary function is to reduce blood calcium levels by inhibiting bone resorption and promoting calcium excretion.
· Calcitonin also exhibits analgesic and anti-inflammatory properties.

​In Vitro and In Vivo Studies:​
· In vitro studies demonstrate that calcitonin significantly inhibits osteoclast activity.
· In vivo studies confirm its efficacy in reducing blood calcium levels and mitigating osteoporosis.
· Clinically, calcitonin is used to treat hypercalcemia, osteoporosis, and other bone disorders.

Complete sequence

Ser · Thr · Tyr · Leu · Gly · Ala · Pro · Ile · Gly · Ser · Asn · Leu · Ser · Glu · Arg · Lys · Val · Leu · Asn · His · Leu · Gln · Ser · Gly · Arg · Ser · Tyr · Ile · Leu · Thr · Ser · NH2

Simplify sequence

STYLGPINGSNLSEKVLNHLQSRTILTS-NH2

CAS

47931-85-1

Molecular formula

C151H231N43O46S2

Molecular weight

3445.89 g/mol

Product Attributes

purity

>98%

form

Lyophilized powder

Storage conditions

-20°C/-80°C


Instructions
  • After receiving the product, please store it in accordance with the conditions recommended in the instructions. Unless otherwise specified, the relevant products are all lyophilized powders. Since trace amounts of polypeptides are deposited in the tube during the lyophilization process, forming a very thin or invisible polypeptide layer,
    Before capping the tube, we recommend centrifuging at about 8,000-12,000 g for 10-30 seconds to allow the peptides attached to the tube cap or tube wall to accumulate at the bottom of the tube.
  • Please refer to relevant literature for the specific optimal working concentration, or explore and optimize through experiments based on the purpose of the experiment and specific cells and animals.
Our company can provide customized synthesis of high-polypeptide, virtual screening of compounds, Animal disease model construction,
Drug safety verification,
Application technology support for gene editing animals, etc.
For specific application consultation, please contact the sales department.

We look forward to your inquiries:

Sales Department 1: Manager Han
Mobile phone: 18701856899
WeChat: 18701856899
QQ: 1295139147
Email: 18701856899@163.com