Calcitonin is a 32-amino acid polypeptide hormone primarily secreted by the parafollicular cells (C cells) of the thyroid gland.
Product Overview
|
Basic Description |
Structure and Function: In Vitro and In Vivo Studies: |
|
Complete sequence |
Ser · Thr · Tyr · Leu · Gly · Ala · Pro · Ile · Gly · Ser · Asn · Leu · Ser · Glu · Arg · Lys · Val · Leu · Asn · His · Leu · Gln · Ser · Gly · Arg · Ser · Tyr · Ile · Leu · Thr · Ser · NH2 |
|
Simplify sequence |
STYLGPINGSNLSEKVLNHLQSRTILTS-NH2 |
|
CAS |
47931-85-1 |
|
Molecular formula |
C151H231N43O46S2 |
|
Molecular weight |
3445.89 g/mol |
Product Attributes
|
purity |
>98% |
|
form |
Lyophilized powder |
|
Storage conditions |
-20°C/-80°C |
