Caperitide is a synthetic peptide consisting of 27 amino acids. It is an analog of human brain natriuretic peptide (BNP) and has diuretic and vasodilatory effects. By activating granular guanylate cyclase, Caperitide can increase intracellular cGMP levels, thereby lowering blood pressure and reducing cardiac workload.
Product Overview
|
Basic Description |
Structure and function: |
|
Three-letter sequence |
Ser-Ser-Gln-Gly-Leu-Gly-Arg-Arg-Pro-Ket-Val-Leu-Gly-Arg-Arg-Pro-Ser-Ser-Cys-Phe-Gly-Gly-Arg-Lys-Met-Asp-Arg-Ile-Gly-Asn-Ser-Tyr |
|
Single letter sequence |
SSQGLGRPRKVLRGRPSSCFGGRKMDRIGNSY |
|
CAS Number |
89213-87-6 |
|
Molecular formula |
C129H206N42O38S |
|
Molecular weight |
3045.36 g/mol |
Product Attributes
|
purity |
>98% |
|
form |
Lyophilized powder |
|
Storage conditions |
Store at -20°C/-80°C away from light |
