Desirudin

Basic Description

​​​​ Structure and function ​:
Desirudin is a 65-amino acid recombinant peptide derived from natural hirudin. ​Reversibly binds to the active site of thrombin​ ​, inhibiting the conversion of fibrinogen to fibrin and blocking thrombin-activated platelet aggregation, thereby preventing thrombosis.

​ ​Application Areas​ ​:
• ​Clinical treatment ​:
- Prevention of deep vein thrombosis (DVT) after hip or knee replacement surgery.
- Alternative anticoagulation therapy in patients with heparin-induced thrombocytopenia (HIT).
• ​​Research ​：Coagulation cascade reaction mechanism and anticoagulant drug development.

​ ​Three-letter sequence​

Val-Val-Tyr-Thr-Pro-Glu-Pro-Ala-Lys-Ala-Glu-Gly-Lys-Pro-Leu-Gln-Glu-Ala-Leu-Lys-Arg-Ile-Ile-Phe-Lys-Ser-His-Asn-Gly-Glu-Asp-NH₂ (the complete sequence needs to be confirmed according to the actual recombinant expression system, this is an example of the core functional domain of hirudin)

​ ​Single letter sequence​

VVYTPEPKAEKPLQEALKRIKFKSHDGED-NH₂ (simplified example, the specific sequence needs to be adjusted according to the recombinant expression system)

Molecular formula

C₂₈₇H₄₃₉N₈₅O₈₆S₇

Molecular weight

6963.5 Da

purity

>98%

form

Lyophilized powder

Storage conditions

Store at -20°C/-80°C away from light