Desirudin is a 65-amino acid recombinant peptide derived from natural hirudin. Reversibly binds to the active site of thrombin , inhibiting the conversion of fibrinogen to fibrin and blocking thrombin-activated platelet aggregation, thereby preventing thrombosis.
Product Overview
|
Basic Description |
Structure and function : |
|
Three-letter sequence |
Val-Val-Tyr-Thr-Pro-Glu-Pro-Ala-Lys-Ala-Glu-Gly-Lys-Pro-Leu-Gln-Glu-Ala-Leu-Lys-Arg-Ile-Ile-Phe-Lys-Ser-His-Asn-Gly-Glu-Asp-NH₂ (the complete sequence needs to be confirmed according to the actual recombinant expression system, this is an example of the core functional domain of hirudin) |
|
Single letter sequence |
VVYTPEPKAEKPLQEALKRIKFKSHDGED-NH₂ (simplified example, the specific sequence needs to be adjusted according to the recombinant expression system) |
|
Molecular formula |
C₂₈₇H₄₃₉N₈₅O₈₆S₇ |
|
Molecular weight |
6963.5 Da |
Product Attributes
|
purity |
>98% |
|
form |
Lyophilized powder |
|
Storage conditions |
Store at -20°C/-80°C away from light |
