Exenatide is a natural peptide extracted from lizard saliva, consisting of 39 amino acids. It is a glucagon-like peptide-1 (GLP-1) receptor agonist that promotes insulin secretion and inhibits glucagon secretion by mimicking the effects of GLP-1, thereby lowering blood sugar levels. Exenatide can also delay gastric emptying, reduce appetite, and help control weight.
Product Overview
Basic Description |
Structure and function: |
Three-letter sequence |
His-Gly-Glu-Gly-Thr-Phe-Thr-Ser-Asp-Leu-Ser-Lys-Gln-Met-Glu-Glu-Glu-Ala-Val-Arg-Leu-Phe-Ile-Glu-Trp-Leu-Lys-Asn-Gly-Gly-Pro-Ser-Ser-Cys-Gly-Phe-Asp-Asp-Ser-Lys |
Single letter sequence |
HGEGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPSK |
CAS Number |
910463-68-2 |
Molecular formula |
C181H267N53O61S |
Molecular weight |
4186.60 g/mol |
Product Attributes
purity |
>98% |
form |
Lyophilized powder |
Storage conditions |
Store at -20°C/-80°C away from light |