Categories
  • Exendin-4
  • Exendin-4

Exendin-4

Exenatide is a natural peptide extracted from lizard saliva, consisting of 39 amino acids. It is a glucagon-like peptide-1 (GLP-1) receptor agonist that promotes insulin secretion and inhibits glucagon secretion by mimicking the effects of GLP-1, thereby lowering blood sugar levels. Exenatide can also delay gastric emptying, reduce appetite, and help control weight.

  • Product Details

  • Technical Support

Product Overview

Basic Description

Structure and function:
Exenatide is a natural peptide extracted from lizard saliva and consists of 39 amino acids.
It is a glucagon-like peptide-1 (GLP-1) receptor agonist that promotes insulin secretion and inhibits glucagon secretion by mimicking the effects of GLP-1, thereby lowering blood sugar levels.
Exenatide can also slow gastric emptying, reduce appetite, and help with weight management.
In vitro and in vivo studies:
In in vitro experiments, exenatide can significantly stimulate the secretion of insulin from pancreatic β cells.
In vivo studies, exenatide was able to effectively lower blood glucose levels and improve cardiovascular risk factors in patients with type 2 diabetes.
Exenatide has shown good glucose-lowering and cardiovascular protective effects in clinical trials.

​Three-letter sequence​

His-Gly-Glu-Gly-Thr-Phe-Thr-Ser-Asp-Leu-Ser-Lys-Gln-Met-Glu-Glu-Glu-Ala-Val-Arg-Leu-Phe-Ile-Glu-Trp-Leu-Lys-Asn-Gly-Gly-Pro-Ser-Ser-Cys-Gly-Phe-Asp-Asp-Ser-Lys

​Single letter sequence​

HGEGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPSK

CAS Number

910463-68-2

Molecular formula

C181H267N53O61S

Molecular weight

4186.60 g/mol

Product Attributes

purity

>98%

form

Lyophilized powder

Storage conditions

Store at -20°C/-80°C away from light


Instructions
  • After receiving the product, please store it in accordance with the conditions recommended in the instructions. Unless otherwise specified, the relevant products are all lyophilized powders. Since trace amounts of polypeptides are deposited in the tube during the lyophilization process, forming a very thin or invisible polypeptide layer,
    Before capping the tube, we recommend centrifuging at about 8,000-12,000 g for 10-30 seconds to allow the peptides attached to the tube cap or tube wall to accumulate at the bottom of the tube.
  • Please refer to relevant literature for the specific optimal working concentration, or explore and optimize through experiments based on the purpose of the experiment and specific cells and animals.
Our company can provide customized synthesis of high-polypeptide, virtual screening of compounds, Animal disease model construction,
Drug safety verification,
Application technology support for gene editing animals, etc.
For specific application consultation, please contact the sales department.

We look forward to your inquiries:

Sales Department 1: Manager Han
Mobile phone: 18701856899
WeChat: 18701856899
QQ: 1295139147
Email: 18701856899@163.com