GLP-1 (7-37) is a 31-amino acid polypeptide. It is the active fragment of glucagon-like peptide-1 (GLP-1) and is mainly secreted by L cells in the intestine. By activating the GLP-1 receptor, GLP-1 (7-37) can promote insulin secretion from pancreatic β cells and inhibit the release of glucagon, thereby lowering blood sugar levels.
Product Overview
Basic Description |
Structure and function: |
Three-letter sequence |
His-Ala-Glu-Gly-Thr-Phe-Thr-Ser-Asp-Val-Ser-Ser-Tyr-Leu-Glu-Gly-Gln-Ala-Ala-Lys-Glu-Phe-Ile-Ala-Trp-Leu-Val-Lys-Gly-Arg-Gly-OH |
Single letter sequence |
HAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG |
CAS Number |
106612-94-6 |
Molecular formula |
C₁₅₃H₂₂₅N₄₃O₄₉ |
Molecular weight |
43297.6 |
Product Attributes
purity |
>98% |
form |
Lyophilized powder |
Storage conditions |
Store at -20°C/-80°C away from light |