Categories
  • GLP-1 (7-37) Glucagon-like peptide
  • GLP-1 (7-37) Glucagon-like peptide

GLP-1 (7-37) Glucagon-like peptide

GLP-1 (7-37) is a 31-amino acid polypeptide. It is the active fragment of glucagon-like peptide-1 (GLP-1) and is mainly secreted by L cells in the intestine. By activating the GLP-1 receptor, GLP-1 (7-37) can promote insulin secretion from pancreatic β cells and inhibit the release of glucagon, thereby lowering blood sugar levels.

  • Product Details

  • Technical Support

Product Overview

Basic Description

Structure and function:
· GLP-1 (7-37) is a polypeptide consisting of 31 amino acids.
It is the active fragment of glucagon-like peptide-1 (GLP-1) and is secreted primarily by L cells in the intestine.
By activating the GLP-1 receptor, GLP-1 (7-37) can promote insulin secretion from pancreatic β cells and inhibit the release of glucagon, thereby lowering blood glucose levels.
GLP-1 (7-37) also slows gastric emptying and reduces appetite, which can help control body weight.
In vitro and in vivo studies:
In vitro, GLP-1 (7-37) can significantly increase insulin secretion and inhibit glucagon secretion.
In vivo experiments, GLP-1 (7-37) can effectively reduce postprandial blood glucose levels and improve glycated hemoglobin (HbA1c) levels in patients with type 2 diabetes.
Clinical trials have shown that GLP-1 (7-37) can reduce the risk of cardiovascular events while lowering blood sugar.

​Three-letter sequence​

His-Ala-Glu-Gly-Thr-Phe-Thr-Ser-Asp-Val-Ser-Ser-Tyr-Leu-Glu-Gly-Gln-Ala-Ala-Lys-Glu-Phe-Ile-Ala-Trp-Leu-Val-Lys-Gly-Arg-Gly-OH

​Single letter sequence​

HAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG

CAS Number

106612-94-6

Molecular formula

C₁₅₃H₂₂₅N₄₃O₄₉

Molecular weight

43297.6

Product Attributes

purity

>98%

form

Lyophilized powder

Storage conditions

Store at -20°C/-80°C away from light


Instructions
  • After receiving the product, please store it in accordance with the conditions recommended in the instructions. Unless otherwise specified, the relevant products are all lyophilized powders. Since trace amounts of polypeptides are deposited in the tube during the lyophilization process, forming a very thin or invisible polypeptide layer,
    Before capping the tube, we recommend centrifuging at about 8,000-12,000 g for 10-30 seconds to allow the peptides attached to the tube cap or tube wall to accumulate at the bottom of the tube.
  • Please refer to relevant literature for the specific optimal working concentration, or explore and optimize through experiments based on the purpose of the experiment and specific cells and animals.
Our company can provide customized synthesis of high-polypeptide, virtual screening of compounds, Animal disease model construction,
Drug safety verification,
Application technology support for gene editing animals, etc.
For specific application consultation, please contact the sales department.

We look forward to your inquiries:

Sales Department 1: Manager Han
Mobile phone: 18701856899
WeChat: 18701856899
QQ: 1295139147
Email: 18701856899@163.com