Categories
  • Glucagon
  • Glucagon

Glucagon

Glucagon is a polypeptide hormone composed of 29 amino acids, which is mainly secreted by the α cells of the pancreas. Its main function is to promote the decomposition of liver glycogen into glucose and inhibit the synthesis of liver glycogen, thereby increasing blood sugar levels. Glucagon is also involved in regulating fat metabolism and protein metabolism.

  • Product Details

  • Technical Support

Product Overview

Basic Description

Structure and function:
Glucagon is a 29-amino acid polypeptide hormone that is primarily secreted by the α cells of the pancreas.
Its main function is to promote the decomposition of liver glycogen into glucose and inhibit liver glycogen synthesis, thereby increasing blood sugar levels.
· Glucagon is also involved in regulating fat metabolism and protein metabolism.
In vitro and in vivo studies:
In vitro, glucagon significantly increased glycogenolysis in hepatocytes.
In vivo, glucagon was able to rapidly raise blood glucose levels in patients with hypoglycemia.
In clinical applications, glucagon is used to treat severe hypoglycemia.

​Three-letter sequence​

His-Ser-Gln-Gly-Thr-Phe-Thr-Ser-Asp-Tyr-Ser-Lys-Tyr-Leu-Asp-Ser-Arg-Arg-Ala-Gln-Asp-Phe-Val-Gln-Trp-Leu-Met-Asn-Thr

​Single letter sequence​

HSQGTFTSDYSKYLDSRRAQD-FVQWLMNT

CAS Number

16941-32-5

Molecular formula

C153H225N43O49S

Molecular weight

3483.00 g/mol

Product Attributes

purity

>98%

form

Lyophilized powder

Storage conditions

Store at -20°C/-80°C away from light


Instructions
  • After receiving the product, please store it in accordance with the conditions recommended in the instructions. Unless otherwise specified, the relevant products are all lyophilized powders. Since trace amounts of polypeptides are deposited in the tube during the lyophilization process, forming a very thin or invisible polypeptide layer,
    Before capping the tube, we recommend centrifuging at about 8,000-12,000 g for 10-30 seconds to allow the peptides attached to the tube cap or tube wall to accumulate at the bottom of the tube.
  • Please refer to relevant literature for the specific optimal working concentration, or explore and optimize through experiments based on the purpose of the experiment and specific cells and animals.
Our company can provide customized synthesis of high-polypeptide, virtual screening of compounds, Animal disease model construction,
Drug safety verification,
Application technology support for gene editing animals, etc.
For specific application consultation, please contact the sales department.

We look forward to your inquiries:

Sales Department 1: Manager Han
Mobile phone: 18701856899
WeChat: 18701856899
QQ: 1295139147
Email: 18701856899@163.com