Glucagon is a polypeptide hormone composed of 29 amino acids, which is mainly secreted by the α cells of the pancreas. Its main function is to promote the decomposition of liver glycogen into glucose and inhibit the synthesis of liver glycogen, thereby increasing blood sugar levels. Glucagon is also involved in regulating fat metabolism and protein metabolism.
Product Overview
Basic Description |
Structure and function: |
Three-letter sequence |
His-Ser-Gln-Gly-Thr-Phe-Thr-Ser-Asp-Tyr-Ser-Lys-Tyr-Leu-Asp-Ser-Arg-Arg-Ala-Gln-Asp-Phe-Val-Gln-Trp-Leu-Met-Asn-Thr |
Single letter sequence |
HSQGTFTSDYSKYLDSRRAQD-FVQWLMNT |
CAS Number |
16941-32-5 |
Molecular formula |
C153H225N43O49S |
Molecular weight |
3483.00 g/mol |
Product Attributes
purity |
>98% |
form |
Lyophilized powder |
Storage conditions |
Store at -20°C/-80°C away from light |