Categories
  • Lixisenatide
  • Lixisenatide

Lixisenatide

Lixisenatide is a synthetic peptide drug that belongs to the glucagon-like peptide-1 (GLP-1) receptor agonist. It is composed of 44 amino acids and can simulate the effects of GLP-1 in the human body. By activating the GLP-1 receptor, lixisenatide can promote the secretion of insulin and inhibit the release of glucagon, thereby lowering blood sugar levels.

  • Product Details

  • Technical Support

Product Overview

Basic Description

Structure and function:
Lixisenatide is a synthetic peptide drug that is a glucagon-like peptide-1 (GLP-1) receptor agonist.
It is composed of 44 amino acids and can mimic the effects of GLP-1 in the human body.
By activating the GLP-1 receptor, lixisenatide can promote the secretion of insulin and inhibit the release of glucagon, thereby lowering blood sugar levels.
Lixisenatide also has the effect of delaying gastric emptying and reducing appetite, which helps to control weight.
In vitro and in vivo studies:
In in vitro experiments, lixisenatide can significantly increase insulin secretion from pancreatic β cells and inhibit glucagon secretion from α cells.
In vivo experiments, lixisenatide can effectively reduce postprandial blood glucose levels and improve glycated hemoglobin (HbA1c) levels in patients with type 2 diabetes.
Clinical trials have shown that lixisenatide can reduce the risk of cardiovascular events while lowering blood sugar.

​Three-letter sequence​

His-Gly-Glu-Gly-Thr-Phe-Thr-Ser-Asp-Leu-Ser-Lys-Gln-Met-Glu-Glu-Glu-Ala-Val-Arg-Leu-Phe-Ile -Glu-Trp-Leu-Lys-Asn-Gly-Gly-Pro-Ser-Ser-Gly-Ala-Pro-Pro-Pro-Ser-Lys-Lys-Lys-Lys-Lys-Lys-NH₂

​Single letter sequence​

HGEGFTTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPSKKKKKK-NH₂

CAS Number

320367-13-3

Molecular formula

C₂₁₅H₃₄₇N₆₁O₆₂S

Molecular weight

4858.0

Product Attributes

purity

>98%

form

Lyophilized powder

Storage conditions

Store at -20°C/-80°C away from light


Instructions
  • After receiving the product, please store it in accordance with the conditions recommended in the instructions. Unless otherwise specified, the relevant products are all lyophilized powders. Since trace amounts of polypeptides are deposited in the tube during the lyophilization process, forming a very thin or invisible polypeptide layer,
    Before capping the tube, we recommend centrifuging at about 8,000-12,000 g for 10-30 seconds to allow the peptides attached to the tube cap or tube wall to accumulate at the bottom of the tube.
  • Please refer to relevant literature for the specific optimal working concentration, or explore and optimize through experiments based on the purpose of the experiment and specific cells and animals.
Our company can provide customized synthesis of high-polypeptide, virtual screening of compounds, Animal disease model construction,
Drug safety verification,
Application technology support for gene editing animals, etc.
For specific application consultation, please contact the sales department.

We look forward to your inquiries:

Sales Department 1: Manager Han
Mobile phone: 18701856899
WeChat: 18701856899
QQ: 1295139147
Email: 18701856899@163.com