Lixisenatide is a synthetic peptide drug that belongs to the glucagon-like peptide-1 (GLP-1) receptor agonist. It is composed of 44 amino acids and can simulate the effects of GLP-1 in the human body. By activating the GLP-1 receptor, lixisenatide can promote the secretion of insulin and inhibit the release of glucagon, thereby lowering blood sugar levels.
Product Overview
Basic Description |
Structure and function: |
Three-letter sequence |
His-Gly-Glu-Gly-Thr-Phe-Thr-Ser-Asp-Leu-Ser-Lys-Gln-Met-Glu-Glu-Glu-Ala-Val-Arg-Leu-Phe-Ile -Glu-Trp-Leu-Lys-Asn-Gly-Gly-Pro-Ser-Ser-Gly-Ala-Pro-Pro-Pro-Ser-Lys-Lys-Lys-Lys-Lys-Lys-NH₂ |
Single letter sequence |
HGEGFTTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPSKKKKKK-NH₂ |
CAS Number |
320367-13-3 |
Molecular formula |
C₂₁₅H₃₄₇N₆₁O₆₂S |
Molecular weight |
4858.0 |
Product Attributes
purity |
>98% |
form |
Lyophilized powder |
Storage conditions |
Store at -20°C/-80°C away from light |