Categories
  • Nesiritide
  • Nesiritide

Nesiritide

Nesiritide is a synthetic polypeptide consisting of 32 amino acids and is an analog of human brain natriuretic peptide (BNP). Its main function is to increase intracellular cGMP levels by activating granular guanylate cyclase, thereby dilating blood vessels, lowering blood pressure and reducing cardiac workload.

  • Product Details

  • Technical Support

Product Overview

Basic Description

Structure and function:
Nesiritide is a synthetic peptide consisting of 32 amino acids and is an analog of human brain natriuretic peptide (BNP).
Its main effect is to increase intracellular cGMP levels by activating granular guanylate cyclase, thereby dilating blood vessels, lowering blood pressure and reducing cardiac workload.
In vitro and in vivo studies:
In in vitro experiments, nesiritide can significantly increase the production of cGMP.
In in vivo experiments, nesiritide can effectively reduce blood pressure and cardiac workload in patients with heart failure.
In clinical applications, nesiritide is used to treat acute decompensated heart failure.

​Three-letter sequence​

Ser-Ser-Gln-Gly-Leu-Gly-Arg-Arg-Pro-Ket-Val-Leu-Gly-Arg-Arg-Pro-Ser-Ser-Cys-Phe-Gly-Gly-Arg-Lys-Met-Asp-Arg-Ile-Gly-Asn-Ser-Tyr

​Single letter sequence​

SSQGLGRPRKVLRGRPSSCFGGRKMDRIGNSY

CAS Number

124584-08-3

Molecular formula

C129H206N42O38S

Molecular weight

3045.36 g/mol

Product Attributes

purity

>98%

form

Lyophilized powder

Storage conditions

Store at -20°C/-80°C away from light


Instructions
  • After receiving the product, please store it in accordance with the conditions recommended in the instructions. Unless otherwise specified, the relevant products are all lyophilized powders. Since trace amounts of polypeptides are deposited in the tube during the lyophilization process, forming a very thin or invisible polypeptide layer,
    Before capping the tube, we recommend centrifuging at about 8,000-12,000 g for 10-30 seconds to allow the peptides attached to the tube cap or tube wall to accumulate at the bottom of the tube.
  • Please refer to relevant literature for the specific optimal working concentration, or explore and optimize through experiments based on the purpose of the experiment and specific cells and animals.
Our company can provide customized synthesis of high-polypeptide, virtual screening of compounds, Animal disease model construction,
Drug safety verification,
Application technology support for gene editing animals, etc.
For specific application consultation, please contact the sales department.

We look forward to your inquiries:

Sales Department 1: Manager Han
Mobile phone: 18701856899
WeChat: 18701856899
QQ: 1295139147
Email: 18701856899@163.com