Nesiritide is a synthetic polypeptide consisting of 32 amino acids and is an analog of human brain natriuretic peptide (BNP). Its main function is to increase intracellular cGMP levels by activating granular guanylate cyclase, thereby dilating blood vessels, lowering blood pressure and reducing cardiac workload.
Product Overview
|
Basic Description |
Structure and function: |
|
Three-letter sequence |
Ser-Ser-Gln-Gly-Leu-Gly-Arg-Arg-Pro-Ket-Val-Leu-Gly-Arg-Arg-Pro-Ser-Ser-Cys-Phe-Gly-Gly-Arg-Lys-Met-Asp-Arg-Ile-Gly-Asn-Ser-Tyr |
|
Single letter sequence |
SSQGLGRPRKVLRGRPSSCFGGRKMDRIGNSY |
|
CAS Number |
124584-08-3 |
|
Molecular formula |
C129H206N42O38S |
|
Molecular weight |
3045.36 g/mol |
Product Attributes
|
purity |
>98% |
|
form |
Lyophilized powder |
|
Storage conditions |
Store at -20°C/-80°C away from light |
