PACAP-27 is a 27-amino acid polypeptide. Its main function is to increase intracellular cAMP levels by activating adenylate cyclase, thereby regulating a variety of physiological functions, including neuroprotection, vasodilation, and endocrine regulation.
Product Overview
|
Basic Description |
Structure and function: |
|
Three-letter sequence |
His-Ser-Asp-Gly-Ile-Phe-Thr-Asp-Ser-Tyr-Ser-Arg-Tyr-Arg-Lys-Gln-Met-Ala-Val-Lys-Lys-Tyr-Leu-Ala-Ala-Val-Leu-Gly-Lys-Arg |
|
Single letter sequence |
HSDGIFTDSYSRYRKQMAVKK-YLAAVLGKR |
|
CAS Number |
127317-03-7 |
|
Molecular formula |
C120H194N38O36S |
|
Molecular weight |
2883.40 g/mol |
Product Attributes
|
purity |
>98% |
|
form |
Lyophilized powder |
|
Storage conditions |
Store at -20°C/-80°C away from light |
