Categories
  • PACAP-27 Pituitary adenylate cyclase activating peptide-27
  • PACAP-27 Pituitary adenylate cyclase activating peptide-27

PACAP-27 Pituitary adenylate cyclase activating peptide-27

PACAP-27 is a 27-amino acid polypeptide. Its main function is to increase intracellular cAMP levels by activating adenylate cyclase, thereby regulating a variety of physiological functions, including neuroprotection, vasodilation, and endocrine regulation.

  • Product Details

  • Technical Support

Product Overview

Basic Description

Structure and function:
PACAP-27 is a polypeptide composed of 27 amino acids.
Its main effect is to increase intracellular cAMP levels by activating adenylate cyclase, thereby regulating a variety of physiological functions, including neuroprotection, vasodilation, and endocrine regulation.
In vitro and in vivo studies:
In in vitro experiments, PACAP-27 can significantly increase the production of cAMP.
In vivo experiments, PACAP-27 was able to effectively protect nerve cells and promote vasodilation.
In clinical applications, PACAP-27 is used to treat neurological and cardiovascular diseases.

​Three-letter sequence​

His-Ser-Asp-Gly-Ile-Phe-Thr-Asp-Ser-Tyr-Ser-Arg-Tyr-Arg-Lys-Gln-Met-Ala-Val-Lys-Lys-Tyr-Leu-Ala-Ala-Val-Leu-Gly-Lys-Arg

​Single letter sequence​

HSDGIFTDSYSRYRKQMAVKK-YLAAVLGKR

CAS Number

127317-03-7

Molecular formula

C120H194N38O36S

Molecular weight

2883.40 g/mol

Product Attributes

purity

>98%

form

Lyophilized powder

Storage conditions

Store at -20°C/-80°C away from light


Instructions
  • After receiving the product, please store it in accordance with the conditions recommended in the instructions. Unless otherwise specified, the relevant products are all lyophilized powders. Since trace amounts of polypeptides are deposited in the tube during the lyophilization process, forming a very thin or invisible polypeptide layer,
    Before capping the tube, we recommend centrifuging at about 8,000-12,000 g for 10-30 seconds to allow the peptides attached to the tube cap or tube wall to accumulate at the bottom of the tube.
  • Please refer to relevant literature for the specific optimal working concentration, or explore and optimize through experiments based on the purpose of the experiment and specific cells and animals.
Our company can provide customized synthesis of high-polypeptide, virtual screening of compounds, Animal disease model construction,
Drug safety verification,
Application technology support for gene editing animals, etc.
For specific application consultation, please contact the sales department.

We look forward to your inquiries:

Sales Department 1: Manager Han
Mobile phone: 18701856899
WeChat: 18701856899
QQ: 1295139147
Email: 18701856899@163.com