des-31-Gly-SMT (Semaglutide Impurities, des-31-Gly-SMT)

Name: des-31-Gly-SMT (Semaglutide Impurities, des-31-Gly-SMT)
Brand: Shanghai Kangna Biotechnology Co., Ltd. official website
Availability: InStock
Rating: 5 (1 reviews)

Des-31-Gly-SMT, a critical process-related impurity in the synthesis of the GLP-1 receptor agonist Semaglutide, is characterized by the absence of the C-terminal glycine residue at position 31 (-Gly-)

联系我们

询盘 View Quote List

Product Details
Technical Support

Product Overview

Description	Structure and Function: des-31-Gly-SMT is an impurity of semaglutide, lacking the glycine residue at position 31. As a GLP-1 receptor agonist, it mimics the action of glucagon-like peptide-1 (GLP-1) secreted by the intestines to regulate blood glucose levels. Due to the missing amino acid residue, its bioactivity and pharmacokinetic properties may differ from those of semaglutide. In Vitro and In Vivo Studies: In vitro studies indicate that des-31-Gly-SMT retains the ability to bind and activate the GLP-1 receptor, though with potentially reduced affinity and potency. In vivo studies suggest that this impurity exhibits weaker glucose-lowering effects and a shorter half-life compared to semaglutide in animal models. Preclinical studies reveal that des-31-Gly-SMT may, in some cases, lead to adverse effects or diminished therapeutic efficacy.
Complete sequence	H-His-Ala-Glu-Gly-Thr-Phe-Thr-Ser-Asp-Val-Ser-Ser-Tyr-Leu-Glu-Gly-Gln-Ala-Ala-Lys-Glu-Phe-Ile-Ala-Trp-Leu-Val-Lys-Gly-Arg-Gly-Asp-Val-Arg-Arg-Arg-Arg-Arg-Arg-Gly-CONH2
Simplify sequence	HHAEGTFTSDVSSYLEGQAAKEFIAWLVKGRGDVRRAARRRRG-NH2
Molecular formula	C187H290N54O59S
Molecular weight	4106.14 g/mol

Product Attributes

purity	>98%
form	Lyophilized powder
Storage conditions	-20°C/-80°C

Instructions

After receiving the product, please store it in accordance with the conditions recommended in the instructions. Unless otherwise specified, the relevant products are all lyophilized powders. Since trace amounts of polypeptides are deposited in the tube during the lyophilization process, forming a very thin or invisible polypeptide layer,
Before capping the tube, we recommend centrifuging at about 8,000-12,000 g for 10-30 seconds to allow the peptides attached to the tube cap or tube wall to accumulate at the bottom of the tube.

Please refer to relevant literature for the specific optimal working concentration, or explore and optimize through experiments based on the purpose of the experiment and specific cells and animals.

Our company can provide customized synthesis of high-polypeptide, virtual screening of compounds, Animal disease model construction,
Drug safety verification, Application technology support for gene editing animals, etc.
For specific application consultation, please contact the sales department.

We look forward to your inquiries:

Sales Department 1: Manager Han
Mobile phone: 18701856899

WeChat: 18701856899

QQ: 1295139147

Email: 18701856899@163.com

des-31-Gly-SMT (Semaglutide Impurities, des-31-Gly-SMT)

Product Details

Technical Support