KN-TP-005
Des-31-Gly-SMT, a critical process-related impurity in the synthesis of the GLP-1 receptor agonist Semaglutide, is characterized by the absence of the C-terminal glycine residue at position 31 (-Gly-)
Product Overview
|
Description |
Structure and Function:
In Vitro and In Vivo Studies:
|
|
Complete sequence |
H-His-Ala-Glu-Gly-Thr-Phe-Thr-Ser-Asp-Val-Ser-Ser-Tyr-Leu-Glu-Gly-Gln-Ala-Ala-Lys-Glu-Phe-Ile-Ala-Trp-Leu-Val-Lys-Gly-Arg-Gly-Asp-Val-Arg-Arg-Arg-Arg-Arg-Arg-Gly-CONH2 |
|
Simplify sequence |
HHAEGTFTSDVSSYLEGQAAKEFIAWLVKGRGDVRRAARRRRG-NH2 |
|
Molecular formula |
C187H290N54O59S |
|
Molecular weight |
4106.14 g/mol |
Product Attributes
|
purity |
>98% |
|
form |
Lyophilized powder |
|
Storage conditions |
-20°C/-80°C |
