Semaglutide is a long-acting glucagon-like peptide-1 (GLP-1) receptor agonist composed of 31 amino acids. It promotes insulin secretion and inhibits glucagon secretion by mimicking the effects of GLP-1, thereby lowering blood sugar levels. Semaglutide can also delay gastric emptying, reduce appetite, and help control weight.
Product Overview
|
Basic Description |
Structure and function: |
|
Three-letter sequence |
His-Ala-Glu-Gly-Thr-Phe-Thr-Ser-Asp-Val-Ser-Ser-Tyr-Leu-Glu-Gly-Gln-Ala-Ala-Lys-Glu-Phe-Ile-Ala-Trp-Leu-Val-Lys-Gly-Arg-Gly |
|
Single letter sequence |
HAEGETFSDVSSTYLGQAAKEFIATWLVRGGRG |
|
CAS Number |
910463-68-2 |
|
Molecular formula |
C187H291N45O55 |
|
Molecular weight |
4113.94 g/mol |
Product Attributes
|
purity |
>98% |
|
form |
Lyophilized powder |
|
Storage conditions |
Store at -20°C/-80°C away from light |
