Tasiroglutide is a synthetic peptide drug that belongs to the glucagon-like peptide-1 (GLP-1) receptor agonist. It is composed of 39 amino acids and its half-life in the body is prolonged by chemical modification. By activating the GLP-1 receptor, tasiroglutide can promote insulin secretion in pancreatic β cells and inhibit the release of glucagon, thereby lowering blood sugar levels.
Product Overview
Basic Description |
Structure and function: |
Three-letter sequence |
|
Single letter sequence |
HGDGSFSDEMNTILDNLAARDFINWLIQTKITD |
CAS Number |
197922-42-2 |
Molecular formula |
C 164 H 252 N 44 O 55 S |
Molecular weight |
3752.13 |
Product Attributes
purity |
>98% |
form |
Lyophilized powder |
Storage conditions |
Store at -20°C/-80°C away from light |