TAT-HA2 Fusion Peptide

Basic Description

Synthesis and Functionality ​:
This peptide is a fusion of the cell penetration domain (TAT, 47-57) of HIV-1 TAT protein and the membrane fusion domain of influenza virus hemagglutinin HA2 subunit, and has both efficient cell penetration and membrane fusion activity. Its functions include:
1. ​​Enhanced drug/gene delivery​ ​：Through TAT-mediated cell penetration and HA2 membrane fusion, the intracellular delivery efficiency of macromolecules (such as nucleic acids and proteins) is improved.
2. ​​Virus entry research​ ​：Simulate the viral membrane fusion mechanism to study the molecular mechanism of virus invasion of host cells.

​ In vitro studies ​:
• Significantly improves transfection efficiency of siRNA or plasmid in cell lines (e.g., HeLa, HEK293).
• Used to construct liposome or nanoparticle carriers to enhance targeted delivery capabilities.

​ In vivo studies ​:
• In mouse models, it was used as an adjuvant component of drug delivery systems to enhance the efficacy of tumor or brain targeted therapies.

​ ​Application Areas​ ​:
• Gene therapy (non-viral vector development)
• Vaccine design (antigen delivery enhancement)
• Virology (research on membrane fusion mechanism)

Complete sequence

YGRKKRRQRRRGLFGAIAGFIENGWEGMIDG

Simplify sequence

TAT-HA2

Molecular formula

C ₁₄₉ H ₂₄₃ N ₅₃ O₃₉S

Molecular weight

3432.92

purity

>95%

form

Lyophilized powder

Storage conditions

Store at -80℃, avoid repeated freezing and thawing