Teriparatide is a synthetic polypeptide consisting of 34 amino acids and is the active fragment of parathyroid hormone (PTH). Its main function is to promote bone formation and increase bone density by activating PTH receptors. Teriparatide also has the function of regulating calcium and phosphorus metabolism.
Product Overview
Basic Description |
Structure and function: |
Three-letter sequence |
Ser-Val-Ser-Glu-Ile-Gln-Leu-Met-His-Asn-Leu-Gly-Lys-His-Leu-Asn-Ser-Met-Glu-Arg-Val-Glu-Trp-Leu-Arg-Lys-Lys-Arg-Arg-Gln-Asp-Val-Asn-Ala |
Single letter sequence |
SVSEIQLMHNLGKHLNSMERV-EWLRKKRRQDVNA |
CAS Number |
52232-67-4 |
Molecular formula |
C171H274N58O50S2 |
Molecular weight |
3927.00 g/mol |
Product Attributes
purity |
>98% |
form |
Lyophilized powder |
Storage conditions |
Store at -20°C/-80°C away from light |