Categories
  • Teriparatide (PTH(1-34))
  • Teriparatide (PTH(1-34))

Teriparatide (PTH(1-34))

Teriparatide is a synthetic polypeptide consisting of 34 amino acids and is the active fragment of parathyroid hormone (PTH). Its main function is to promote bone formation and increase bone density by activating PTH receptors. Teriparatide also has the function of regulating calcium and phosphorus metabolism.

  • Product Details

  • Technical Support

Product Overview

Basic Description

Structure and function:
Teriparatide is a synthetic peptide consisting of 34 amino acids and is the active fragment of parathyroid hormone (PTH).
Its main function is to promote bone formation and increase bone density by activating PTH receptors.
Teriparatide also has the effect of regulating calcium and phosphorus metabolism.
In vitro and in vivo studies:
In in vitro experiments, teriparatide can significantly increase the activity of osteoblasts.
In vivo experiments, teriparatide was able to effectively increase bone density and reduce the risk of fractures.
In clinical applications, teriparatide is used to treat osteoporosis.

​Three-letter sequence​

Ser-Val-Ser-Glu-Ile-Gln-Leu-Met-His-Asn-Leu-Gly-Lys-His-Leu-Asn-Ser-Met-Glu-Arg-Val-Glu-Trp-Leu-Arg-Lys-Lys-Arg-Arg-Gln-Asp-Val-Asn-Ala

​Single letter sequence​

SVSEIQLMHNLGKHLNSMERV-EWLRKKRRQDVNA

CAS Number

52232-67-4

Molecular formula

C171H274N58O50S2

Molecular weight

3927.00 g/mol

Product Attributes

purity

>98%

form

Lyophilized powder

Storage conditions

Store at -20°C/-80°C away from light


Instructions
  • After receiving the product, please store it in accordance with the conditions recommended in the instructions. Unless otherwise specified, the relevant products are all lyophilized powders. Since trace amounts of polypeptides are deposited in the tube during the lyophilization process, forming a very thin or invisible polypeptide layer,
    Before capping the tube, we recommend centrifuging at about 8,000-12,000 g for 10-30 seconds to allow the peptides attached to the tube cap or tube wall to accumulate at the bottom of the tube.
  • Please refer to relevant literature for the specific optimal working concentration, or explore and optimize through experiments based on the purpose of the experiment and specific cells and animals.
Our company can provide customized synthesis of high-polypeptide, virtual screening of compounds, Animal disease model construction,
Drug safety verification,
Application technology support for gene editing animals, etc.
For specific application consultation, please contact the sales department.

We look forward to your inquiries:

Sales Department 1: Manager Han
Mobile phone: 18701856899
WeChat: 18701856899
QQ: 1295139147
Email: 18701856899@163.com