Categories
  • Teriparatide
  • Teriparatide

Teriparatide

Recombinant human parathyroid hormone (1-34 fragment), promotes bone formation and treats osteoporosis

  • Product Details

  • Technical Support

Product Overview

Basic Description

Structure and function ​:
Teriparatide is the N-terminal 1-34 active fragment of human parathyroid hormone (PTH), which regulates bone metabolism in both directions by activating the PTH/PTHrP receptor (PPR) of osteoblasts:
1. ​​Promote bone formation​ ​:Intermittent administration can stimulate osteoblast differentiation and increase bone density.
2. ​​Anti-bone resorption ​:Inhibit osteoclast activity and reduce bone loss.

​Application Areas​ ​:
• ​Clinical treatment ​: FDA-approved osteoporosis medication (particularly for patients at high risk of fracture).
• ​​Research ​:Bone metabolism regulation mechanism, bone tissue engineering (such as development of bone regeneration materials).

Complete sequence

Ser-Val-Ser-Glu-Ile-Gln-Leu-Met-His-Asn-Leu-Gly-Lys-His-Leu-Asn-Ser-Met-Glu-Arg-Val-Glu-Trp-Leu-Arg-Lys-Lys-Leu-Gln-Asp-Val

Simplify sequence

SVSEIQLMHNLGKHLNSMERVEWLRKKLQDV

Molecular formula

C₁₈₁H₂₉₁N₅₅O₅₁S₂

Molecular weight

4117.8

Product Attributes

purity

>99%

form

Lyophilized powder

Storage conditions

Store at -80°C away from light


Instructions
  • After receiving the product, please store it in accordance with the conditions recommended in the instructions. Unless otherwise specified, the relevant products are all lyophilized powders. Since trace amounts of polypeptides are deposited in the tube during the lyophilization process, forming a very thin or invisible polypeptide layer,
    Before capping the tube, we recommend centrifuging at about 8,000-12,000 g for 10-30 seconds to allow the peptides attached to the tube cap or tube wall to accumulate at the bottom of the tube.
  • Please refer to relevant literature for the specific optimal working concentration, or explore and optimize through experiments based on the purpose of the experiment and specific cells and animals.
Our company can provide customized synthesis of high-polypeptide, virtual screening of compounds, Animal disease model construction,
Drug safety verification,
Application technology support for gene editing animals, etc.
For specific application consultation, please contact the sales department.

We look forward to your inquiries:

Sales Department 1: Manager Han
Mobile phone: 18701856899
WeChat: 18701856899
QQ: 1295139147
Email: 18701856899@163.com