Categories
  • Tirzepatide
  • Tirzepatide

Tirzepatide

Tirzepatide is a new dual receptor agonist that acts on both GIP (glucose-dependent insulinotropic polypeptide) and GLP-1 (glucagon-like peptide-1) receptors. It is mainly used to treat type 2 diabetes, significantly improving blood sugar control through dual mechanisms, and has the additional benefit of weight loss. Clinical studies have shown that tirzepatide is effective in lowering blood sugar and reducing weight, providing an innovative treatment option for diabetes management.

  • Product Details

  • Technical Support

Product Overview

Basic Description

Structure and function:
Tipol is a synthetic peptide that is a GLP-1 receptor agonist.
Its main effect is to promote insulin secretion and inhibit glucagon secretion by activating GLP-1 receptors, thereby lowering blood sugar levels.
· Tipoleptide also has weight loss and cardiovascular protective effects.
In vitro and in vivo studies:
In in vitro experiments, tebuconazole can significantly increase insulin secretion and inhibit glucagon secretion.
In vivo experiments, tebuconazole was able to effectively lower blood glucose levels and reduce body weight in patients with type 2 diabetes.
In clinical applications, tebuconazole is used to treat type 2 diabetes and obesity.

​Three-letter sequence​

H - His - Ala - Gly - Gly - Thr - Phe - Thr - Ser - Asp - Val - Ser - Ser - Tyr - Leu - Glu - Gln - Leu - Lys - Gly - Gly - Pro - Ser - Ser - Ala - Val - Arg - Leu - Phe - Ile - Glu - Trp - Leu - Lys - Asn - Gly - Gly - Pro - Gly - Ala - Pro - Pro - Ala - Ile - Pro - Leu - Lys - Thr - Tyr - Pro - NH2

​Single letter sequence​

H - HAEGTFTSDVSSYLEQLKGGPSSAVRLFIEWLKNGGPGAPPALPILLKTYPR - OH

CAS Number

2023788-19-2

Molecular formula

C235H358N64O72S

Molecular weight

5233.01g/mol

Product Attributes

purity

>98%

form

Lyophilized powder

Storage conditions

Store at -20°C/-80°C away from light


Instructions
  • Please store the product immediately according to the recommended conditions in the instructions upon receipt. Unless otherwise specified, all products are freeze-dried powders. Since trace amounts of peptides are deposited in the tube during the freeze-drying process, forming a very thin or invisible peptide layer, we recommend centrifuging at about 8,000-12,000g for 10-30 seconds in a centrifuge before opening the tube cap, so that the peptides attached to the tube cap or tube wall are aggregated at the bottom of the tube.
  • Please refer to relevant literature for the specific optimal working concentration, or explore and optimize through experiments based on the purpose of the experiment and specific cells and animals.
Our company can provide customized synthesis of high-polypeptide, virtual screening of compounds, Animal disease model construction,
Drug safety verification,
Application technology support for gene editing animals, etc.
For specific application consultation, please contact the sales department.

We look forward to your inquiries:

Sales Department 1: Manager Han
Mobile phone: 18701856899
WeChat: 18701856899
QQ: 1295139147
Email: 18701856899@163.com