Tirzepatide is a new dual receptor agonist that acts on both GIP (glucose-dependent insulinotropic polypeptide) and GLP-1 (glucagon-like peptide-1) receptors. It is mainly used to treat type 2 diabetes, significantly improving blood sugar control through dual mechanisms, and has the additional benefit of weight loss. Clinical studies have shown that tirzepatide is effective in lowering blood sugar and reducing weight, providing an innovative treatment option for diabetes management.
Product Overview
|
Basic Description |
Structure and function: |
|
Three-letter sequence |
H - His - Ala - Gly - Gly - Thr - Phe - Thr - Ser - Asp - Val - Ser - Ser - Tyr - Leu - Glu - Gln - Leu - Lys - Gly - Gly - Pro - Ser - Ser - Ala - Val - Arg - Leu - Phe - Ile - Glu - Trp - Leu - Lys - Asn - Gly - Gly - Pro - Gly - Ala - Pro - Pro - Ala - Ile - Pro - Leu - Lys - Thr - Tyr - Pro - NH2 |
|
Single letter sequence |
H - HAEGTFTSDVSSYLEQLKGGPSSAVRLFIEWLKNGGPGAPPALPILLKTYPR - OH |
|
CAS Number |
2023788-19-2 |
|
Molecular formula |
C235H358N64O72S |
|
Molecular weight |
5233.01g/mol |
Product Attributes
|
purity |
>98% |
|
form |
Lyophilized powder |
|
Storage conditions |
Store at -20°C/-80°C away from light |
