β-Amyloid (1-40)

Basic Description

Structure and function ​:
β-Amyloid (1-40) is a 40-amino acid polypeptide, which is generated by cleavage of amyloid precursor protein (APP) by β- and γ-secretase. Compared with Aβ42, it has a lower aggregation tendency, but it is still one of the components of amyloid plaques in Alzheimer's disease (AD), and is involved in neuronal damage and vascular amyloid pathology.

​ ​Research Applications​ ​:
• ​In vitro studies ​：Study amyloid aggregation dynamics and toxicity mechanisms (such as oxidative stress and mitochondrial dysfunction).
• ​In vivo studies ​：Used for pathological analysis or drug efficacy evaluation of AD transgenic animal models (such as APP/PS1 mice).

​ Features ​:
- Available in trifluoroacetate (TFA) or lyophilized powder form with high solubility and stability.
- Its aggregation state needs to be controlled through specific treatment (such as HFIP pretreatment).

Complete sequence

Asp-Ala-Glu-Phe-Arg-His-Asp-Ser-Gly-Tyr-Glu-Val-His-His-Gln-Lys-Leu-Val-Phe-Phe-Ala-Glu-Asp-Val-Gly-Ser-Asn-Lys-Gly-Ala-Ile-Ile-Gly-Leu-Met

Simplify sequence

DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLM

Molecular formula

C₁₉₄H₂₉₅N₅₃O₅₈S

Molecular weight

4329.80

purity

>95%

form

Lyophilized powder

Storage conditions

Store in a dry place at -80°C away from light