Categories
  • Liraglutide
  • Liraglutide

Liraglutide

Liraglutide is a long-acting glucagon-like peptide-1 (GLP-1) receptor agonist composed of 31 amino acids. It promotes insulin secretion and inhibits glucagon secretion by mimicking the effects of GLP-1, thereby lowering blood sugar levels.

  • Product Details

  • Technical Support

Product Overview

Basic Description

Structure and function:
Liraglutide is a long-acting glucagon-like peptide-1 (GLP-1) receptor agonist composed of 31 amino acids.
It promotes insulin secretion and inhibits glucagon secretion by mimicking the effects of GLP-1, thereby lowering blood sugar levels.
Liraglutide can also slow gastric emptying, reduce appetite, and help with weight management.
In vitro and in vivo studies:
In in vitro experiments, liraglutide can significantly stimulate the secretion of insulin by pancreatic β cells.
In vivo studies, liraglutide was able to effectively lower blood glucose levels and improve cardiovascular risk factors in patients with type 2 diabetes.
Liraglutide has shown good glucose-lowering and cardiovascular protective effects in clinical trials.

​Three-letter sequence​

His-Ala-Glu-Gly-Thr-Phe-Thr-Ser-Asp-Val-Ser-Ser-Tyr-Leu-Glu-Gly-Gln-Ala-Ala-Lys-Glu-Phe-Ile-Ala-Trp-Leu-Val-Lys-Gly-Arg-Gly

​Single letter sequence​

HAEGETFSDVSSTYLGQAAKEFIATWLVRGGRG

CAS Number

204656-20-2

Molecular formula

C172H265N43O51

Molecular weight

3751.20 g/mol

Product Attributes

purity

>98%

form

Lyophilized powder

Storage conditions

Store at -20°C/-80°C away from light


Instructions
  • After receiving the product, please store it in accordance with the conditions recommended in the instructions. Unless otherwise specified, the relevant products are all lyophilized powders. Since trace amounts of polypeptides are deposited in the tube during the lyophilization process, forming a very thin or invisible polypeptide layer,
    Before capping the tube, we recommend centrifuging at about 8,000-12,000 g for 10-30 seconds to allow the peptides attached to the tube cap or tube wall to accumulate at the bottom of the tube.
  • Please refer to relevant literature for the specific optimal working concentration, or explore and optimize through experiments based on the purpose of the experiment and specific cells and animals.
Our company can provide customized synthesis of high-polypeptide, virtual screening of compounds, Animal disease model construction,
Drug safety verification,
Application technology support for gene editing animals, etc.
For specific application consultation, please contact the sales department.

We look forward to your inquiries:

Sales Department 1: Manager Han
Mobile phone: 18701856899
WeChat: 18701856899
QQ: 1295139147
Email: 18701856899@163.com