Liraglutide is a long-acting glucagon-like peptide-1 (GLP-1) receptor agonist composed of 31 amino acids. It promotes insulin secretion and inhibits glucagon secretion by mimicking the effects of GLP-1, thereby lowering blood sugar levels.
Product Overview
Basic Description |
Structure and function: |
Three-letter sequence |
His-Ala-Glu-Gly-Thr-Phe-Thr-Ser-Asp-Val-Ser-Ser-Tyr-Leu-Glu-Gly-Gln-Ala-Ala-Lys-Glu-Phe-Ile-Ala-Trp-Leu-Val-Lys-Gly-Arg-Gly |
Single letter sequence |
HAEGETFSDVSSTYLGQAAKEFIATWLVRGGRG |
CAS Number |
204656-20-2 |
Molecular formula |
C172H265N43O51 |
Molecular weight |
3751.20 g/mol |
Product Attributes
purity |
>98% |
form |
Lyophilized powder |
Storage conditions |
Store at -20°C/-80°C away from light |