Semaglutide Impurities, des-10-Val-SMT

Name: Semaglutide Impurities, des-10-Val-SMT
Brand: Shanghai Kangna Biotechnology Co., Ltd. official website
Availability: InStock
Rating: 5 (1 reviews)

The semaglutide impurity des-10-Val-SMT is a structural defect impurity that may be produced during the synthesis or degradation of semaglutide. Semaglutide is a long-acting GLP-1 analogue, mainly used to treat type 2 diabetes and obesity. This impurity is different from the standard drug molecule structure due to the lack of the valine (Val) residue at the 10th position, which may affect the purity and biological activity of the drug. Therefore, its content needs to be strictly monitored in drug quality control.

Inquiry View Quote List

Product Details
Technical Support

Product Overview

Basic Description	Structure and function: 1. des-10-Val-SMT is an impurity of semaglutide that lacks the valine residue at position 10. 2. It is a GLP-1 receptor agonist that regulates blood glucose levels by mimicking intestinal secretion of glucagon-like peptide-1 (GLP-1). 3. Due to the lack of an amino acid residue, its biological activity and pharmacokinetic properties may differ from those of semaglutide. In vitro and in vivo studies: 1. In vitro studies have shown that des-10-Val-SMT is still able to bind to and activate the GLP-1 receptor, but its affinity and potency may be reduced. 2. In vivo studies have shown that the hypoglycemic effect of this impurity in animal models is weaker than that of semaglutide, and its half-life may be shorter. 3. Preclinical studies have shown that des-10-Val-SMT may cause adverse reactions or reduced efficacy in some cases.
Three-letter sequence	H-His-Ala-Glu-Gly-Thr-Phe-Thr-Ser-Asp-Val-Ser-Ser-Tyr-Leu-Glu-Gly-Gln-Ala-Lys-Glu-Phe-Ile-Ala-Trp-Leu-Val-Lys-Gly-Asp-Val-Arg-Arg-Arg-Arg-Arg-Arg-Gly-CONH2
Single letter sequence	HHAEGTFTSDVSSYLEGQAKKEFIAWLVKGDVRRAARRRRG-NH2
Molecular formula	C183H284N51O56S
Molecular weight	4034.16 g/mol

Product Attributes

purity	>98%
form	Lyophilized powder
Storage conditions	Store at -20°C/-80°C away from light

Instructions

Please store the product immediately according to the recommended conditions in the instructions upon receipt. Unless otherwise specified, all products are freeze-dried powders. Since trace amounts of peptides are deposited in the tube during the freeze-drying process, forming a very thin or invisible peptide layer, we recommend centrifuging at about 8,000-12,000g for 10-30 seconds in a centrifuge before opening the tube cap, so that the peptides attached to the tube cap or tube wall are aggregated at the bottom of the tube.

Please refer to relevant literature for the specific optimal working concentration, or explore and optimize through experiments based on the purpose of the experiment and specific cells and animals.

Our company can provide customized synthesis of high-polypeptide, virtual screening of compounds, Animal disease model construction,
Drug safety verification, Application technology support for gene editing animals, etc.
For specific application consultation, please contact the sales department.

We look forward to your inquiries:

Sales Department 1: Manager Han
Mobile phone: 18701856899

WeChat: 18701856899

QQ: 1295139147

Email: 18701856899@163.com

Semaglutide Impurities, des-10-Val-SMT

Product Details

Technical Support