The semaglutide impurity des-11-Ser-SMT is a structural analogue that may be produced during the synthesis or storage of semaglutide. Semaglutide is a long-acting GLP-1 receptor agonist widely used in the treatment of type 2 diabetes and obesity. This impurity is different from the original drug structure due to the lack of the serine (Ser) residue at the 11th position, which may affect the purity and biological activity of the drug. Therefore, its content needs to be strictly controlled during drug development and production.
Product Overview
Basic Description |
Structure and function: |
Three-letter sequence |
H-His-Ala-Glu-Gly-Thr-Phe-Thr-Ser-Asp-Val-Ser-Tyr-Leu-Glu-Gly-Gln-Ala-Lys-Glu-Phe-Ile-Ala-Trp-Leu-Val-Lys-Gly-Asp-Val-Arg-Arg-Arg-Arg-Arg-Arg-Gly-CONH2 |
Single letter sequence |
HHAEGTFTSDVSSTYLEGQAKKEFIAWLVKGDVRRAARRRRG-NH2 |
Molecular formula |
C183H284N51O56S |
Molecular weight |
4034.16 g/mol |
Product Attributes
purity |
>98% |
form |
Lyophilized powder |
Storage conditions |
Store at -20°C/-80°C away from light |