The semaglutide impurity des-13-Tyr-SMT is an impurity produced during the degradation or synthesis of semaglutide. Semaglutide is a GLP-1 receptor agonist mainly used to treat type 2 diabetes and obesity. This impurity is different from the complete structure of semaglutide due to the lack of tyrosine (Tyr) at position 13, which may affect the purity and efficacy of the drug, so it needs to be strictly monitored in drug quality control.
Product Overview
|
Basic Description |
Structure and function: |
|
Three-letter sequence |
H-His-Ala-Glu-Gly-Thr-Phe-Thr-Ser-Asp-Val-Ser-Ser-Leu-Glu-Gly-Gln-Ala-Lys-Glu-Phe-Ile-Ala-Trp-Leu-Val-Lys-Gly-Asp-Val-Arg-Arg-Arg-Arg-Arg-Arg-Gly-CONH2 |
|
Single letter sequence |
HHAEGTFTSDVSSLLEGQAKKEFIAWLVKGDVRRAARRRRG-NH2 |
|
Molecular formula |
C183H284N51O56S |
|
Molecular weight |
4034.16 g/mol |
Product Attributes
|
purity |
>98% |
|
form |
Lyophilized powder |
|
Storage conditions |
Store at -20°C/-80°C away from light |
