Categories
  • Semaglutide Impurities, des-13-Tyr-SMT
  • Semaglutide Impurities, des-13-Tyr-SMT

Semaglutide Impurities, des-13-Tyr-SMT

The semaglutide impurity des-13-Tyr-SMT is a structurally related impurity that may be produced during the synthesis or storage of semaglutide (a long-acting GLP-1 receptor agonist used to treat type 2 diabetes and obesity). This impurity lacks the tyrosine residue at position 13 (des-13-Tyr), which may cause slight changes in the molecular conformation or receptor binding ability. In drug production and quality control, this impurity needs to be strictly monitored to ensure that the purity, stability and clinical efficacy of semaglutide meet the standards.

  • Product Details

  • Technical Support

Product Overview

Basic Description

Structure and function:
1. des-13-Tyr-SMT is an impurity of semaglutide that lacks the tyrosine residue at position 13.
2. This deficiency may affect its GLP-1 receptor binding ability and biological activity.
3. Due to the lack of a key amino acid residue, its overall structure and function may be affected.
In vitro and in vivo studies:
1. In in vitro experiments, the GLP-1 receptor activation ability of des-13-Tyr-SMT was lower than that of semaglutide.
2. In vivo studies have shown that this impurity also reduces the effect of blood sugar control.
3. Studies in animal models have shown that this impurity may lead to reduced drug efficacy, but the specific mechanism needs further study.
4. Preclinical studies suggest that the safety of des-13-Tyr-SMT needs further evaluation.

​Three-letter sequence​

His-Ala-Glu-Gly-Thr-Phe-Thr-Ser-Asp-Val-Ser-Ser-Tyr-Leu-Glu-Gly-Gln-Ala-Ala-Lys-Glu-Phe-Ile-Ala-Trp-Leu-Val-Lys-Gly-Arg-Gly

​Single letter sequence​

HAEGETTFSDVSSYLEGQAAKELIAWLVRGRG

Molecular formula

C178H259N45O55S

Molecular weight

4,067.9 g/mol

Product Attributes

purity

>98%

form

Lyophilized powder

Storage conditions

Store at -20°C/-80°C away from light


Instructions
  • Please store the product immediately according to the recommended conditions in the instructions upon receipt. Unless otherwise specified, all products are freeze-dried powders. Since trace amounts of peptides are deposited in the tube during the freeze-drying process, forming a very thin or invisible peptide layer, we recommend centrifuging at about 8,000-12,000g for 10-30 seconds in a centrifuge before opening the tube cap, so that the peptides attached to the tube cap or tube wall are aggregated at the bottom of the tube.
  • Please refer to relevant literature for the specific optimal working concentration, or explore and optimize through experiments based on the purpose of the experiment and specific cells and animals.
Our company can provide customized synthesis of high-polypeptide, virtual screening of compounds, Animal disease model construction,
Drug safety verification,
Application technology support for gene editing animals, etc.
For specific application consultation, please contact the sales department.

We look forward to your inquiries:

Sales Department 1: Manager Han
Mobile phone: 18701856899
WeChat: 18701856899
QQ: 1295139147
Email: 18701856899@163.com