The semaglutide impurity des-15-Glu,16-Gly-SMT is a structurally modified impurity that may be produced during the synthesis or degradation of semaglutide (a GLP-1 analog hypoglycemic drug). The impurity lacks glutamic acid (Glu) at position 15 and glycine (Gly) at position 16 in the molecular structure, and may be accompanied by other modifications (such as SMT fragments). Such structural variations may affect the biological activity and stability of the drug, so its content must be strictly controlled during drug production and storage to ensure the quality and safety of the drug.
Product Overview
Basic Description |
Structure and function: |
Three-letter sequence |
H-His-Ala-Glu-Gly-Thr-Phe-Thr-Ser-Asp-Val-Ser-Ser-Tyr-Leu-Glu-Gln-Ala-Lys-Glu-Phe-Ile-Ala-Trp-Leu-Val-Lys-Gly-Asp-Val-Arg-Arg-Arg-Arg-Arg-Arg-Gly-CONH2 |
Single letter sequence |
HHAEGTFTSDVSSYLEQAKKEFIAWLVKGDVRRAARRRRG-NH2 |
Molecular formula |
C183H284N51O56S |
Molecular weight |
4034.16 g/mol |
Product Attributes
purity |
>98% |
form |
Lyophilized powder |
Storage conditions |
Store at -20°C/-80°C away from light |