The semaglutide impurity des-15-Glu,16-Gly-SMT is a structurally modified impurity of semaglutide, which lacks glutamic acid (Glu) at position 15 and glycine (Gly) at position 16 in its molecular structure. Semaglutide is a long-acting GLP-1 analogue widely used in the treatment of type 2 diabetes and obesity. This impurity may be produced during peptide chain synthesis or later purification, and its presence may affect the stability and pharmacodynamic properties of the drug. Therefore, its content must be strictly controlled during drug development and production to ensure the safety and effectiveness of the product.
Product Overview
Basic Description |
Structure and function: |
Three-letter sequence |
H-His-Ala-Glu-Gly-Thr-Phe-Thr-Ser-Asp-Val-Ser-Ser-Tyr-Leu-Glu-Gln-Ala-Lys-Glu-Phe-Ile-Ala-Trp-Leu-Val-Lys-Gly-Asp-Val-Arg-Arg-Arg-Arg-Arg-Arg-Gly-CONH2 |
Single letter sequence |
HHAEGTFTSDVSSYLEQAKKEFIAWLVKGDVRRAARRRRG-NH2 |
Molecular formula |
C183H284N51O56S |
Molecular weight |
4034.16 g/mol |
Product Attributes
purity |
>98% |
form |
Lyophilized powder |
Storage conditions |
Store at -20°C/-80°C away from light |