The semaglutide impurity des-16-Gly-SMT is an impurity that may be produced during the synthesis or degradation of semaglutide (a GLP-1 analog used to treat type 2 diabetes and obesity). This impurity is missing the 16th glycine residue (des-16-Gly), which may affect the integrity and efficacy of the drug. Strict monitoring of such impurities is essential to ensure the quality and safety of semaglutide.
Product Overview
|
Basic Description |
Structure and function: |
|
Three-letter sequence |
H-His-Ala-Glu-Gly-Thr-Phe-Thr-Ser-Asp-Val-Ser-Ser-Tyr-Leu-Glu-Gln-Ala-Lys-Glu-Phe-Ile-Ala-Trp-Leu-Val-Lys-Gly-Asp-Val-Arg-Arg-Arg-Arg-Arg-Arg-Gly-CONH2 |
|
Single letter sequence |
HHAEGTFTSDVSSYLEQAKKEFIAWLVKGDVRRAARRRRG-NH2 |
|
Molecular formula |
C183H284N51O56S |
|
Molecular weight |
4034.16 g/mol |
Product Attributes
|
purity |
>98% |
|
form |
Lyophilized powder |
|
Storage conditions |
Store at -20°C/-80°C away from light |
