The semaglutide impurity des-17-Gln-SMT is a structural analogue of semaglutide, missing glutamine (Gln) at position 17. Semaglutide is a long-acting GLP-1 receptor agonist used to treat type 2 diabetes and obesity. This impurity may be produced during drug synthesis or degradation, and its presence may affect the purity and biological activity of the drug, so it needs to be strictly monitored during quality control.
Product Overview
|
Basic Description |
Structure and function: |
|
Three-letter sequence |
H-His-Ala-Glu-Gly-Thr-Phe-Thr-Ser-Asp-Val-Ser-Ser-Tyr-Leu-Glu-Gly-Ala-Lys-Glu-Phe-Ile-Ala-Trp-Leu-Val-Lys-Gly-Asp-Val-Arg-Arg-Arg-Arg-Arg-Arg-Gly-CONH2 |
|
Single letter sequence |
HHAEGTFTSDVSSYLEGAKKEFIAWLVKGDVRRAARRRRG-NH2 |
|
Molecular formula |
C184H286N52O57S |
|
Molecular weight |
4062.17 g/mol |
Product Attributes
|
purity |
>98% |
|
form |
Lyophilized powder |
|
Storage conditions |
Store at -20°C/-80°C away from light |
