The semaglutide impurity des-18-Ala-SMT is a structural analogue that may be produced during the synthesis or degradation of semaglutide (a GLP-1 receptor agonist hypoglycemic drug). This impurity lacks alanine (Ala) at the 18th position of the C-terminus, which may affect the integrity and biological activity of the drug. Its detection and analysis are of great significance for drug quality control, process optimization and safety assessment.
Product Overview
|
Basic Description |
Structure and function: |
|
Three-letter sequence |
H-His-Ala-Glu-Gly-Thr-Phe-Thr-Ser-Asp-Val-Ser-Ser-Tyr-Leu-Glu-Gly-Gln-Lys-Glu-Phe-Ile-Ala-Trp-Leu-Val-Lys-Gly-Asp-Val-Arg-Arg-Arg-Arg-Arg-Arg-Gly-CONH2 |
|
Single letter sequence |
HHAEGTFTSDVSSYLEGQKKEFIAWLVKGDVRRAARRRRG-NH2 |
|
Molecular formula |
C184H286N52O57S |
|
Molecular weight |
4062.17 g/mol |
Product Attributes
|
purity |
>98% |
|
form |
Lyophilized powder |
|
Storage conditions |
Store at -20°C/-80°C away from light |
