The semaglutide impurity des-18-Ala-SMT is a structural analogue that may be produced during the synthesis or degradation of semaglutide (a GLP-1 receptor agonist hypoglycemic drug). This impurity lacks alanine (Ala) at the 18th position of the C-terminus, which may affect the integrity and biological activity of the drug. Its detection and analysis are of great significance for drug quality control, process optimization and safety assessment.
Product Overview
Basic Description |
Structure and function: |
Three-letter sequence |
H-His-Ala-Glu-Gly-Thr-Phe-Thr-Ser-Asp-Val-Ser-Ser-Tyr-Leu-Glu-Gly-Gln-Lys-Glu-Phe-Ile-Ala-Trp-Leu-Val-Lys-Gly-Asp-Val-Arg-Arg-Arg-Arg-Arg-Arg-Gly-CONH2 |
Single letter sequence |
HHAEGTFTSDVSSYLEGQKKEFIAWLVKGDVRRAARRRRG-NH2 |
Molecular formula |
C184H286N52O57S |
Molecular weight |
4062.17 g/mol |
Product Attributes
purity |
>98% |
form |
Lyophilized powder |
Storage conditions |
Store at -20°C/-80°C away from light |