The semaglutide impurity des-18-Ala-SMT is a related impurity of semaglutide, which is similar in structure to semaglutide but lacks alanine (Ala) at position 18. Semaglutide is a GLP-1 receptor agonist mainly used to treat type 2 diabetes and obesity. This impurity may be generated during drug synthesis or storage, and its presence may affect the purity and potency of the drug, so it needs to be strictly controlled.
Product Overview
|
Basic Description |
Structure and function: |
|
Three-letter sequence |
H-His-Ala-Glu-Gly-Thr-Phe-Thr-Ser-Asp-Val-Ser-Ser-Tyr-Leu-Glu-Gly-Gln-Lys-Glu-Phe-Ile-Ala-Trp-Leu-Val-Lys-Gly-Asp-Val-Arg-Arg-Arg-Arg-Arg-Arg-Gly-CONH2 |
|
Single letter sequence |
HHAEGTFTSDVSSYLEGQKKEFIAWLVKGDVRRAARRRRG-NH2 |
|
Molecular formula |
C184H286N52O57S |
|
Molecular weight |
4062.17 g/mol |
Product Attributes
|
purity |
>98% |
|
form |
Lyophilized powder |
|
Storage conditions |
Store at -20°C/-80°C away from light |
