Semaglutide impurities include des-20-1-AEEA, 20-2-AEEA, 20-3-γ-Glu and 20-4-Octadecanedioic Acid-SMT, which are specific structural derivatives produced during the synthesis or degradation of semaglutide. Semaglutide is a GLP-1 receptor agonist, mainly used to treat type 2 diabetes and obesity. These impurities may be formed by amino acid deletion (such as des-20-1-AEEA), side chain modification (such as AEEA or γ-glutamyl group connection) or fatty acid chain changes (such as octadecane dioic acid replacement). Their presence may affect the purity and efficacy of the drug and needs to be strictly monitored in quality control.
Product Overview
|
Basic Description |
Structure and function: |
|
Three-letter sequence |
H-His-Ala-Glu-Gly-Thr-Phe-Thr-Ser-Asp-Val-Ser-Ser-Tyr-Leu-Glu-Gly-Gln-Ala-Lys-Ile-Trp-Leu-Val-Lys-Gly-Asp-Val-Arg-Arg-Arg-Arg-Arg-Arg-Gly-CONH2 |
|
Single letter sequence |
HHAEGTFTSDVSSYLEGQAKITWLVLVKGDVRRAARRRRG-NH2 |
|
Molecular formula |
C178H272N46O51S |
|
Molecular weight |
3866.10 g/mol |
Product Attributes
|
purity |
>98% |
|
form |
Lyophilized powder |
|
Storage conditions |
Store at -20°C/-80°C away from light |
