The semaglutide impurity des-20-Lys (AEEA-AEEA-γ-Glu-Octadecanedioic Acid)-SMT is a structurally modified impurity of semaglutide. The fatty diacid modification group (AEEA-AEEA-γ-Glu-Octadecanedioic Acid) on the side chain of lysine (Lys) at position 20 is missing from its molecular structure. This modification group is the key structure for semaglutide to achieve long-acting effects, and significantly prolongs the half-life of the drug by binding to albumin.
Product Overview
Basic Description |
Structure and function: |
Three-letter sequence |
H-His-Ala-Glu-Gly-Thr-Phe-Thr-Ser-Asp-Val-Ser-Ser-Tyr-Leu-Glu-Gly-Gln-Ala-Ile-Trp-Leu-Val-Lys-Gly-Asp-Val-Arg-Arg-Arg-Arg-Arg-Arg-Gly-CONH2 |
Single letter sequence |
HHAEGTFTSDVSSYLEGQAITWLVLVKGDVRRAARRRRG-NH2 |
Molecular formula |
C178H272N46O51S |
Molecular weight |
3866.10 g/mol |
Product Attributes
purity |
>98% |
form |
Lyophilized powder |
Storage conditions |
Store at -20°C/-80°C away from light |