Semaglutide impurity des-21-Glu-SMT is a structural analogue of Semaglutide, which lacks glutamic acid (Glu) at position 21 in its molecular structure. As a GLP-1 receptor agonist drug, Semaglutide significantly improves blood sugar control and promotes weight management in patients with type 2 diabetes by mimicking the mechanism of action of natural GLP-1.
Product Overview
Basic Description |
Structure and function: |
Three-letter sequence |
H-His-Ala-Glu-Gly-Thr-Phe-Thr-Ser-Asp-Val-Ser-Ser-Tyr-Leu-Glu-Gly-Gln-Ala-Lys-Ile-Trp-Leu-Val-Lys-Gly-Asp-Val-Arg-Arg-Arg-Arg-Arg-Arg-Gly-CONH2 |
Single letter sequence |
HHAEGTFTSDVSSYLEGQAKITWLVLVKGDVRRAARRRRG-NH2 |
Molecular formula |
C179H274N47O52S |
Molecular weight |
3894.11 g/mol |
Product Attributes
purity |
>98% |
form |
Lyophilized powder |
Storage conditions |
Store at -20°C/-80°C away from light |