Semaglutide impurity des-22-Phe-SMT is a structural analogue of Semaglutide, which lacks phenylalanine (Phe) at position 22 in its molecular structure. Semaglutide is a long-acting GLP-1 receptor agonist widely used in the treatment of type 2 diabetes and obesity, and works by regulating blood sugar, delaying gastric emptying and enhancing satiety.
Product Overview
|
Basic Description |
Structure and function: |
|
Three-letter sequence |
H-His-Ala-Glu-Gly-Thr-Phe-Thr-Ser-Asp-Val-Ser-Ser-Tyr-Leu-Glu-Gly-Gln-Ala-Lys-Glu-Ile-Trp-Leu-Val-Lys-Gly-Asp-Val-Arg-Arg-Arg-Arg-Arg-Arg-Gly-CONH2 |
|
Single letter sequence |
HHAEGTFTSDVSSYLEGQAKEITWLVLVKGDVRRAARRRRG-NH2 |
|
Molecular formula |
C180H276N48O53S |
|
Molecular weight |
3922.12 g/mol |
Product Attributes
|
purity |
>98% |
|
form |
Lyophilized powder |
|
Storage conditions |
Store at -20°C/-80°C away from light |
