The semaglutide impurity des-25-Trp-SMT is a structurally related impurity of semaglutide, characterized by the absence of a tryptophan (Trp) residue at position 25 in the molecule. This impurity may be produced during drug synthesis or storage, and may affect the biological activity and stability of the drug. In drug quality control, its content needs to be strictly monitored to ensure that the purity and efficacy of semaglutide products meet the standards.
Product Overview
Basic Description |
Structure and function: |
Three-letter sequence |
H-His-Ala-Glu-Gly-Thr-Phe-Thr-Ser-Asp-Val-Ser-Ser-Tyr-Leu-Glu-Gly-Gln-Ala-Ala-Lys-Glu-Phe-Ile-Ala-Leu-Val-Lys-Gly-Asp-Val-Arg-Arg-Arg-Arg-Arg-Arg-Gly-CONH2 |
Single letter sequence |
HHAEGTFTSDVSSYLEGQAAKEFIALEVVKGDVRRAARRRRG-NH2 |
Molecular formula |
C183H282N50O55S |
Molecular weight |
4006.15 g/mol |
Product Attributes
purity |
>98% |
form |
Lyophilized powder |
Storage conditions |
Store at -20°C/-80°C away from light |