The semaglutide impurity des-26-Leu-SMT is a structural analog that may be produced during the synthesis or degradation of the GLP-1 analog semaglutide. It is characterized by the absence of the 26th leucine (Leu) residue, which may lead to changes in molecular activity or stability. This impurity needs to be strictly monitored in drug quality control to ensure the safety and efficacy of semaglutide preparations.
Product Overview
Basic Description |
Structure and function: |
Three-letter sequence |
H-His-Ala-Glu-Gly-Thr-Phe-Thr-Ser-Asp-Val-Ser-Ser-Tyr-Leu-Glu-Gly-Gln-Ala-Ala-Lys-Glu-Phe-Ile-Ala-Trp-Leu-Val-Lys-Gly-Asp-Val-Arg-Arg-Arg-Arg-Arg-Arg-Gly-CONH2 |
Single letter sequence |
HHAEGTFTSDVSSYLEGQAAKEFIAWLVKGDVRRAARRRRG-NH2 |
Molecular formula |
C184H284N51O56S |
Molecular weight |
4034.16 g/mol |
Product Attributes
purity |
>98% |
form |
Lyophilized powder |
Storage conditions |
Store at -20°C/-80°C away from light |