The semaglutide impurity des-5-Thr-SMT is a structural analogue that may be produced during the synthesis or degradation of semaglutide (a GLP-1 receptor agonist used to treat type 2 diabetes and obesity). The impurity is characterized by the absence of the threonine (Thr) residue at position 5, which may cause changes in the molecular structure and affect the stability and biological activity of the drug. Strict monitoring of impurities such as des-5-Thr-SMT is of great significance to ensure the quality, safety and efficacy of semaglutide.
Product Overview
Basic Description |
Structure and function: |
Three-letter sequence |
H-His-Ala-Glu-Gly-Phe-Thr-Ser-Asp-Val-Ser-Ser-Tyr-Leu-Glu-Gly-Gln-Ala-Lys-Glu-Phe-Ile-Ala-Trp-Leu-Val-Lys-Gly-Asp-Val-Arg-Arg-Arg-Arg-Arg-Arg-Gly-CONH2 |
Single letter sequence |
HHAEGFPFTSDVSSYLEGQAKKEFIAWLVKGDVRRAARRRRG-NH2 |
Molecular formula |
C183H284N51O56S |
Molecular weight |
4034.16 g/mol |
Product Attributes
purity |
>98% |
form |
Lyophilized powder |
Storage conditions |
Store at -20°C/-80°C away from light |