The semaglutide impurity des-6-Phe-SMT is an impurity that may be produced during the synthesis or degradation of semaglutide (a GLP-1 analog used to treat type 2 diabetes and obesity). This impurity is characterized by the absence of the phenylalanine (Phe) residue at position 6, which may affect the integrity and biological activity of the drug. Strict monitoring of impurities such as des-6-Phe-SMT is essential to ensure the purity and efficacy of semaglutide.
Product Overview
Basic Description |
Structure and function: |
Three-letter sequence |
H-His-Ala-Glu-Gly-Thr-Thr-Ser-Asp-Val-Ser-Ser-Tyr-Leu-Glu-Gly-Gln-Ala-Lys-Glu-Phe-Ile-Ala-Trp-Leu-Val-Lys-Gly-Asp-Val-Arg-Arg-Arg-Arg-Arg-Arg-Gly-CONH2 |
Single letter sequence |
HHAEGTTSDVSSYLEGQAKKEFIAWLVKGDVRRAARRRRG-NH2 |
Molecular formula |
C183H284N51O56S |
Molecular weight |
4034.16 g/mol |
Product Attributes
purity |
>98% |
form |
Lyophilized powder |
Storage conditions |
Store at -20°C/-80°C away from light |