The semaglutide impurity des-8-Ser-SMT is a structural analogue that may be generated during the preparation of semaglutide. As a GLP-1 receptor agonist composed of 31 amino acids, semaglutide plays an important role in the treatment of type 2 diabetes and obesity. The impurity has a change in molecular structure due to the loss of the serine (Ser) residue at position 8, which may affect the purity and pharmacological activity of the drug. During the drug development and production process, strict qualitative and quantitative control of this impurity is required to ensure that the quality of the final product meets pharmaceutical standards.
Product Overview
Basic Description |
Structure and function: |
Three-letter sequence |
H-His-Ala-Glu-Gly-Thr-Phe-Thr-Asp-Val-Ser-Ser-Tyr-Leu-Glu-Gly-Gln-Ala-Lys-Glu-Phe-Ile-Ala-Trp-Leu-Val-Lys-Gly-Asp-Val-Arg-Arg-Arg-Arg-Arg-Arg-Gly-CONH2 |
Single letter sequence |
HHAEGTFTDVSSTYLEGQAKKEFIAWLVKGDVRRAARRRRG-NH2 |
Molecular formula |
C183H284N51O56S |
Molecular weight |
4034.16 g/mol |
Product Attributes
purity |
>98% |
form |
Lyophilized powder |
Storage conditions |
Store at -20°C/-80°C away from light |