Categories

Semaglutide Impurities, endo-14a-Glu,14b-Gly-SMT

The semaglutide impurity endo-14a-Glu,14b-Gly-SMT is a structural analogue that may be produced during the synthesis or degradation of semaglutide (a GLP-1 receptor agonist hypoglycemic drug). Its molecular structure contains specific modifications of glutamic acid (Glu) at position 14a and glycine (Gly) at position 14b, which may affect the purity and pharmacological activity of the drug. The study of this impurity is of great significance to drug quality control and safety assessment.


  • Product Details

  • Technical Support

Product Overview

Basic Description

Structure and function:
1. endo-14a-Glu,14b-Gly-SMT is an impurity of semaglutide, in which an additional glutamic acid residue is inserted into the side chain of the 14th tyrosine residue and the original glycine residue is retained.
2. It is a GLP-1 receptor agonist that regulates blood glucose levels by mimicking intestinal secretion of glucagon-like peptide-1 (GLP-1).
3. Due to the insertion of an additional amino acid residue, its biological activity and pharmacokinetic properties may differ from those of semaglutide.
In vitro and in vivo studies:
1. In vitro studies have shown that endo-14a-Glu,14b-Gly-SMT is still able to bind to and activate the GLP-1 receptor, but its affinity and potency may be reduced.
2. In vivo studies have shown that the hypoglycemic effect of this impurity in animal models is weaker than that of semaglutide, and its half-life may be shorter.
3. Preclinical studies have shown that endo-14a-Glu,14b-Gly-SMT may cause adverse reactions or reduced efficacy in some cases.

​Three-letter sequence​

H-His-Ala-Glu-Gly-Thr-Phe-Thr-Ser-Asp-Val-Ser-Ser-Tyr-Leu-Glu-Gly-Gln-Ala-Lys-Glu-Phe-Ile-Ala-Trp-Leu-Val-Lys-Gly-Asp-Val-Arg-Arg-Arg-Arg-Arg-Arg-Gly-CONH2

​Single letter sequence​

HHAEGTFTSDVSSYLEGQAKKEFIAWLVKGDVRRAARRRRG-NH2

Molecular formula

C187H290N54O59S

Molecular weight

4106.14 g/mol

Product Attributes

purity

>98%

form

Lyophilized powder

Storage conditions

Store at -20°C/-80°C away from light


Instructions
  • Please store the product immediately according to the recommended conditions in the instructions upon receipt. Unless otherwise specified, all products are freeze-dried powders. Since trace amounts of peptides are deposited in the tube during the freeze-drying process, forming a very thin or invisible peptide layer, we recommend centrifuging at about 8,000-12,000g for 10-30 seconds in a centrifuge before opening the tube cap, so that the peptides attached to the tube cap or tube wall are aggregated at the bottom of the tube.
  • Please refer to relevant literature for the specific optimal working concentration, or explore and optimize through experiments based on the purpose of the experiment and specific cells and animals.
Our company can provide customized synthesis of high-polypeptide, virtual screening of compounds, Animal disease model construction,
Drug safety verification,
Application technology support for gene editing animals, etc.
For specific application consultation, please contact the sales department.

We look forward to your inquiries:

Sales Department 1: Manager Han
Mobile phone: 18701856899
WeChat: 18701856899
QQ: 1295139147
Email: 18701856899@163.com