The semaglutide impurity endo-14a-Glu,14b-Gly-SMT is a structural analogue that may be produced during the synthesis or degradation of semaglutide (a GLP-1 receptor agonist hypoglycemic drug). Its molecular structure contains specific modifications of glutamic acid (Glu) at position 14a and glycine (Gly) at position 14b, which may affect the purity and pharmacological activity of the drug. The study of this impurity is of great significance to drug quality control and safety assessment.
Product Overview
Basic Description |
Structure and function: |
Three-letter sequence |
H-His-Ala-Glu-Gly-Thr-Phe-Thr-Ser-Asp-Val-Ser-Ser-Tyr-Leu-Glu-Gly-Gln-Ala-Lys-Glu-Phe-Ile-Ala-Trp-Leu-Val-Lys-Gly-Asp-Val-Arg-Arg-Arg-Arg-Arg-Arg-Gly-CONH2 |
Single letter sequence |
HHAEGTFTSDVSSYLEGQAKKEFIAWLVKGDVRRAARRRRG-NH2 |
Molecular formula |
C187H290N54O59S |
Molecular weight |
4106.14 g/mol |
Product Attributes
purity |
>98% |
form |
Lyophilized powder |
Storage conditions |
Store at -20°C/-80°C away from light |