The semaglutide impurity endo-16a-Gln-SMT is a structurally modified impurity that may be produced during the synthesis or storage of semaglutide (a long-acting GLP-1 analog used to treat type 2 diabetes and obesity). This impurity is formed by substitution of glutamine (Gln), and its molecular structure variation may affect the purity and biological activity of the drug. As a key quality attribute indicator, its content needs to be strictly monitored by analytical methods such as chromatography-mass spectrometry (LC-MS) to ensure that it meets the limited standards for impurity control in the ICH guidelines and ensure the safety and effectiveness of clinical medication.
Product Overview
|
Basic Description |
Structure and function: |
|
Three-letter sequence |
H-His-Ala-Glu-Gly-Thr-Phe-Thr-Ser-Asp-Val-Ser-Ser-Tyr-Leu-Glu-Gly-Gln-Ala-Lys-Glu-Ile-Trp-Leu-Val-Lys-Gly-Asp-Val-Arg-Arg-Arg-Arg-Arg-Arg-Gly-CONH2 |
|
Single letter sequence |
HHAEGTFTSDVSSYLEGQAKEITWLVLVKGDVRRAARRRRG-NH2 |
|
Molecular formula |
C187H290N54O59S |
|
Molecular weight |
4106.14 g/mol |
Product Attributes
|
purity |
>98% |
|
form |
Lyophilized powder |
|
Storage conditions |
Store at -20°C/-80°C away from light |
