The semaglutide impurity endo-22a-Ile-SMT is a structural analogue of semaglutide (a long-acting GLP-1 receptor agonist used to treat type 2 diabetes and obesity) that may be produced during the synthesis or degradation process. This impurity is formed by isoleucine (Ile) modification and may affect the purity and biological activity of the drug. In drug quality control, such impurities need to be strictly monitored to ensure that the safety and efficacy of the preparation meet the standards.
Product Overview
|
Basic Description |
Structure and function: |
|
Three-letter sequence |
H-His-Ala-Glu-Gly-Thr-Phe-Thr-Ser-Asp-Val-Ser-Ser-Tyr-Leu-Glu-Gly-Gln-Ala-Lys-Glu-Ile-Trp-Leu-Val-Lys-Gly-Asp-Val-Arg-Arg-Arg-Arg-Arg-Arg-Gly-CONH2 |
|
Single letter sequence |
HHAEGTFTSDVSSYLEGQAKEITWLVLVKGDVRRAARRRRG-NH2 |
|
Molecular formula |
C187H290N54O59S |
|
Molecular weight |
4106.14 g/mol |
Product Attributes
|
purity |
>98% |
|
form |
Lyophilized powder |
|
Storage conditions |
Store at -20°C/-80°C away from light |
