Endo-23a-Ala-SMT is a type of impurity in semaglutide. As an important drug for the treatment of type 2 diabetes and other diseases, the control of impurities in semaglutide is crucial to the quality and safety of the drug. Endo-23a-Ala-SMT is an impurity of a specific structure, and its presence may affect the purity, stability and pharmacological activity of semaglutide. In-depth research and strict control of it will help ensure the effectiveness and safety of semaglutide and provide reliable protection for patients' medication.
Product Overview
|
Basic Description |
Structure and function: |
|
Three-letter sequence |
H-His-Ala-Glu-Gly-Thr-Phe-Thr-Ser-Asp-Val-Ser-Ser-Tyr-Leu-Glu-Gly-Gln-Ala-Lys-Glu-Phe-Ala-Trp-Leu-Val-Lys-Gly-Asp-Val-Arg-Arg-Arg-Arg-Arg-Arg-Gly-CONH2 |
|
Single letter sequence |
HHAEGTFTSDVSSYLEGQAKKEFAWLVLVKGDVRRAARRRRG-NH2 |
|
Molecular formula |
C187H290N54O59S |
|
Molecular weight |
4106.14 g/mol |
Product Attributes
|
purity |
>98% |
|
form |
Lyophilized powder |
|
Storage conditions |
Store at -20°C/-80°C away from light |
