The semaglutide impurity endo-24a-Trp-SMT is an impurity that may be produced during the synthesis or degradation of semaglutide (a GLP-1 receptor agonist used to treat type 2 diabetes and obesity). The impurity structure contains tryptophan (Trp) modification, which may affect the purity and efficacy of the drug. Strict monitoring of such impurities is essential to ensure drug safety and quality.
Product Overview
|
Basic Description |
Structure and function: |
|
Three-letter sequence |
H-His-Ala-Glu-Gly-Thr-Phe-Thr-Ser-Asp-Val-Ser-Ser-Tyr-Leu-Glu-Gly-Gln-Ala-Lys-Glu-Phe-Ile-Trp-Leu-Val-Lys-Gly-Asp-Val-Arg-Arg-Arg-Arg-Arg-Arg-Gly-CONH2 |
|
Single letter sequence |
HHAEGTFTSDVSSYLEGQAKKEFWLVLVKGDVRRAARRRRG-NH2 |
|
Molecular formula |
C187H290N54O59S |
|
Molecular weight |
4106.14 g/mol |
Product Attributes
|
purity |
>98% |
|
form |
Lyophilized powder |
|
Storage conditions |
Store at -20°C/-80°C away from light |
