The semaglutide impurity endo-25a-Leu-SMT is an impurity that may be produced during the synthesis or degradation of semaglutide. Semaglutide is a GLP-1 receptor agonist, mainly used to treat type 2 diabetes and obesity. This impurity (endo-25a-Leu-SMT) may be formed due to amino acid sequence modification or structural changes, and needs to be strictly monitored in drug quality control to ensure the safety and efficacy of the drug.
Product Overview
Basic Description |
Structure and function: |
Three-letter sequence |
H-His-Ala-Glu-Gly-Thr-Phe-Thr-Ser-Asp-Val-Ser-Ser-Tyr-Leu-Glu-Gly-Gln-Ala-Lys-Glu-Phe-Ile-Ala-Leu-Trp-Leu-Val-Lys-Gly-Asp-Val-Arg-Arg-Arg-Arg-Arg-Arg-Gly-CONH2 |
Single letter sequence |
HHAEGTFTSDVSSYLEGQAAKEFIALEWLVLVKGDVRRAARRRRG-NH2 |
Molecular formula |
C187H290N54O59S |
Molecular weight |
4106.14 g/mol |
Product Attributes
purity |
>98% |
form |
Lyophilized powder |
Storage conditions |
Store at -20°C/-80°C away from light |