The semaglutide impurity endo-28a-Gly,28b-Arg-SMT is a structurally modified impurity that may be produced during the synthesis or degradation of semaglutide (a long-acting GLP-1 receptor agonist). Semaglutide is mainly used to treat type 2 diabetes and obesity. It enhances glucose-dependent insulin secretion, suppresses appetite and delays gastric emptying by mimicking the effects of GLP-1.
Product Overview
|
Basic Description |
Structure and function: |
|
Three-letter sequence |
H-His-Ala-Glu-Gly-Thr-Phe-Thr-Ser-Asp-Val-Ser-Ser-Tyr-Leu-Glu-Gly-Gln-Ala-Lys-Glu -Phe-Ile-Ala-Trp-Leu-Val-Lys-Gly-Gly-Arg-Asp-Val-Arg-Arg-Arg-Arg-Arg-Arg-Gly-CONH2 |
|
Single letter sequence |
HHAEGTFTSDVSSYLEGQAAKEFIAWLVKGGRDVRRAARRRRG-NH2 |
|
Molecular formula |
C188H292N55O60S |
|
Molecular weight |
4134.16 g/mol |
Product Attributes
|
purity |
>98% |
|
form |
Lyophilized powder |
|
Storage conditions |
Store at -20°C/-80°C away from light |
