The semaglutide impurity endo-28a-Gly-SMT is a structurally related impurity that may be produced during the synthesis or storage of semaglutide, a GLP-1 receptor agonist. Semaglutide is primarily used to treat type 2 diabetes and obesity, and works by enhancing insulin secretion, inhibiting glucagon release, and delaying gastric emptying.
Product Overview
Basic Description |
Structure and function: |
Three-letter sequence |
H-His-Ala-Glu-Gly-Thr-Phe-Thr-Ser-Asp-Val-Ser-Ser-Tyr-Leu-Glu-Gly-Gln-Ala-Lys-Glu-Phe-Ile-Ala-Trp-Leu-Val-Lys-Gly-Asp-Val-Arg-Arg-Arg-Arg-Arg-Arg-Gly-CONH2 |
Single letter sequence |
HHAEGTFTSDVSSYLEGQAAKEFIAWLVKGDVRRAARRRRG-NH2 |
Molecular formula |
C186H288N53O58S |
Molecular weight |
4089.17 g/mol |
Product Attributes
purity |
>98% |
form |
Lyophilized powder |
Storage conditions |
Store at -20°C/-80°C away from light |