The semaglutide impurity endo-30a-Gly-SMT is an impurity that may be produced during the synthesis or degradation of semaglutide (a GLP-1 analog). Semaglutide is mainly used to treat type 2 diabetes and obesity, and works by regulating insulin secretion and suppressing appetite. This impurity may be formed during drug production or storage and needs to be strictly controlled to ensure the safety and efficacy of the drug.
Product Overview
|
Basic Description |
Structure and function: |
|
Three-letter sequence |
H-His-Ala-Glu-Gly-Thr-Phe-Thr-Ser-Asp-Val-Ser-Ser-Tyr-Leu-Glu-Gly-Gln-Ala-Lys-Glu-Phe-Ile-Ala-Trp-Leu-Val-Lys-Gly-Gly-Asp-Val-Arg-Arg-Arg-Arg-Arg-Arg-Gly-CONH2 |
|
Single letter sequence |
HHAEGTFTSDVSSYLEGQAAKEFIAWLVKGGDVRRAARRRRG-NH2 |
|
Molecular formula |
C187H290N54O59S |
|
Molecular weight |
4106.14 g/mol |
Product Attributes
|
purity |
>98% |
|
form |
Lyophilized powder |
|
Storage conditions |
Store at -20°C/-80°C away from light |
